| Product Number |
ARP39580_P050 |
| Product Page |
www.avivasysbio.com/hoxa6-antibody-middle-region-arp39580-p050.html |
| Name |
HOXA6 Antibody - middle region (ARP39580_P050) |
| Protein Size (# AA) |
233 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
3203 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Homeobox A6 |
| Alias Symbols |
HOX1, HOX1B, HOX1.2 |
| Peptide Sequence |
Synthetic peptide located within the following region: YLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kosaki,K., (2002) Teratology 65 (2), 50-62 |
| Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXA6 (ARP39580_P050) antibody |
| Blocking Peptide |
For anti-HOXA6 (ARP39580_P050) antibody is Catalog # AAP39580 (Previous Catalog # AAPP21593) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HOXA6 |
| Uniprot ID |
P31267 |
| Protein Name |
Homeobox protein Hox-A6 |
| Protein Accession # |
NP_076919 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024014 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXA6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Small Intestine
 | WB Suggested Anti-HOXA6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine |
|
|
