| Product Number |
ARP39573_P050 |
| Product Page |
www.avivasysbio.com/jmjd4-antibody-c-terminal-region-arp39573-p050.html |
| Name |
JMJD4 Antibody - C-terminal region (ARP39573_P050) |
| Protein Size (# AA) |
463 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
65094 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Jumonji domain containing 4 |
| Peptide Sequence |
Synthetic peptide located within the following region: AAFDVGRITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The function of JMJD4 remains unkonwn. |
| Protein Interactions |
SPAG8; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-JMJD4 (ARP39573_P050) antibody |
| Blocking Peptide |
For anti-JMJD4 (ARP39573_P050) antibody is Catalog # AAP39573 (Previous Catalog # AAPP21586) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD4 |
| Uniprot ID |
Q9H9V9 |
| Protein Name |
JmjC domain-containing protein 4 |
| Protein Accession # |
NP_075383 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_023007 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
JMJD4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 91%; Pig: 91%; Rat: 91% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-JMJD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
