ZNF70 Antibody - C-terminal region (ARP39515_T100)

• Product Number: ARP39515_T100
• Name: ZNF70 Antibody - C-terminal region (ARP39515_T100)
• Protein Size (# AA): 446 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 7621
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 70
• Alias Symbols: Cos17
• Peptide Sequence: Synthetic peptide located within the following region: GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Collins,J.E., Genome Biol. 5 (10), R84 (2004)
• Description of Target: The function of the ZNF70 has not yet been determined
• Protein Interactions: ZFP64;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF70 (ARP39515_T100) antibody is Catalog # AAP39515 (Previous Catalog # AAPP21531)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF70
• Uniprot ID: Q9UC06
• Protein Name: Zinc finger protein 70
• Protein Accession #: NP_068735
• Purification: Protein A purified
• Nucleotide Accession #: NM_021916
• Tested Species Reactivity: Human
• Gene Symbol: ZNF70
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 77%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 83%; Rat: 100%; Zebrafish: 83%
• Image 1: Human Stomach
  
  Human Stomach
• Image 2: Human HepG2
  
  WB Suggested Anti-ZNF70 Antibody Titration: 5.0ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate