website statistics
Product Datasheet: ARP39509_T100 - FOXA2 antibody - C-terminal region (ARP39509_T100) - Aviva Systems Biology
FOXA2 antibody - C-terminal region (ARP39509_T100)
Data Sheet
Product Number ARP39509_T100
Product Page
Product Name FOXA2 antibody - C-terminal region (ARP39509_T100)
Size 100 ul
Gene Symbol FOXA2
Alias Symbols HNF3B, TCF3B
Protein Size (# AA) 457 amino acids
Molecular Weight 48kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 3170
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Forkhead box A2
Description This is a rabbit polyclonal antibody against FOXA2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS
Target Reference Verschuur,M., (2005) J. Biol. Chem. 280 (17), 16763-16771
Description of Target FOXA2 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.
Protein Interactions PPARGC1B; GSC; EN2; OTX2; ONECUT1; NCOA1; TLE1; MIP; HOXA5; LHX1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-FOXA2 (ARP39509_T100) antibody is Catalog # AAP39509 (Previous Catalog # AAPP21525)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA2
Complete computational species homology data Anti-FOXA2 (ARP39509_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FOXA2.
Swissprot Id Q9Y261
Protein Name Hepatocyte nuclear factor 3-beta
Sample Type Confirmation

FOXA2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_068556
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FOXA2.
Nucleotide Accession # NM_021784
Replacement Item This antibody may replace item sc-101060 from Santa Cruz Biotechnology.
Conjugation Options

ARP39509_T100-FITC Conjugated

ARP39509_T100-HRP Conjugated

ARP39509_T100-Biotin Conjugated

CB Replacement sc-101060; sc-176240; sc-20692; sc-271103; sc-271104; sc-35569; sc-35570; sc-6553; sc-6554; sc-9187
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-FOXA2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate

FOXA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |