| Product Number |
ARP39504_T100 |
| Product Page |
www.avivasysbio.com/prdm12-antibody-c-terminal-region-arp39504-t100.html |
| Name |
PRDM12 Antibody - C-terminal region (ARP39504_T100) |
| Protein Size (# AA) |
367 amino acids |
| Molecular Weight |
40 kDa |
| NCBI Gene Id |
59335 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
PR domain containing 12 |
| Alias Symbols |
PFM9, HSAN8 |
| Peptide Sequence |
Synthetic peptide located within the following region: NHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Reid,A.G. (2004) Leukemia 18 (1), 178-180 |
| Description of Target |
PRDM12 belongs to PR-domain family which are involved in human cancers in an unusual yin-yang fashion. Two products are normally produced from a PR-domain family member which differ by the presence or absence of the PR domain; the PR-plus product is disrupted or underexpressed whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, a result of either genetic or epigenetic events, appears to be an important cause of malignancy. PRDM12 may have a potential role in the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-PRDM12 (ARP39504_T100) antibody |
| Blocking Peptide |
For anti-PRDM12 (ARP39504_T100) antibody is Catalog # AAP39504 (Previous Catalog # AAPP21520) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM12 |
| Uniprot ID |
Q9H4Q4 |
| Protein Name |
PR domain zinc finger protein 12 |
| Protein Accession # |
NP_067632 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021619 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PRDM12 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PRDM12 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
|
