Product Number |
ARP39497_P050 |
Product Page |
www.avivasysbio.com/znf71-antibody-n-terminal-region-arp39497-p050.html |
Name |
ZNF71 Antibody - N-terminal region (ARP39497_P050) |
Protein Size (# AA) |
489 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
58491 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 71 |
Alias Symbols |
EZFIT |
Peptide Sequence |
Synthetic peptide located within the following region: MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Mataki,C., (2000) J. Atheroscler. Thromb. 7 (2), 97-103 |
Description of Target |
ZNF71 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Protein Interactions |
KDM1A; PRKCZ; PLK1; CSNK2B; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF71 (ARP39497_P050) antibody |
Blocking Peptide |
For anti-ZNF71 (ARP39497_P050) antibody is Catalog # AAP39497 (Previous Catalog # AAPP23063) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF71 |
Uniprot ID |
Q9NQZ8 |
Protein Name |
Endothelial zinc finger protein induced by tumor necrosis factor alpha |
Protein Accession # |
NP_067039 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_021216 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF71 |
Predicted Species Reactivity |
Human, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Yeast: 75% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF71 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|