ZNF71 Antibody - N-terminal region (ARP39497_P050)

Data Sheet
 
Product Number ARP39497_P050
Product Page www.avivasysbio.com/znf71-antibody-n-terminal-region-arp39497-p050.html
Name ZNF71 Antibody - N-terminal region (ARP39497_P050)
Protein Size (# AA) 489 amino acids
Molecular Weight 54kDa
NCBI Gene Id 58491
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 71
Alias Symbols EZFIT
Peptide Sequence Synthetic peptide located within the following region: MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mataki,C., (2000) J. Atheroscler. Thromb. 7 (2), 97-103
Description of Target ZNF71 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Protein Interactions KDM1A; PRKCZ; PLK1; CSNK2B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF71 (ARP39497_P050) antibody
Blocking Peptide For anti-ZNF71 (ARP39497_P050) antibody is Catalog # AAP39497 (Previous Catalog # AAPP23063)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF71
Uniprot ID Q9NQZ8
Protein Name Endothelial zinc finger protein induced by tumor necrosis factor alpha
Protein Accession # NP_067039
Purification Affinity Purified
Nucleotide Accession # NM_021216
Tested Species Reactivity Human
Gene Symbol ZNF71
Predicted Species Reactivity Human, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Yeast: 75%
Image 1
Human Jurkat
WB Suggested Anti-ZNF71 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com