| Product Number |
ARP39489_T100 |
| Product Page |
www.avivasysbio.com/grhl3-antibody-c-terminal-region-arp39489-t100.html |
| Name |
GRHL3 Antibody - C-terminal region (ARP39489_T100) |
| Protein Size (# AA) |
627 amino acids |
| Molecular Weight |
70 kDa |
| NCBI Gene Id |
57822 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Grainyhead-like 3 (Drosophila) |
| Description |
|
| Alias Symbols |
SOM, VWS2, TFCP2L4 |
| Peptide Sequence |
Synthetic peptide located within the following region: EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ting,S.B., Biochem. J. 370 (PT 3), 953-962 (2003) |
| Description of Target |
GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined.This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined. |
| Protein Interactions |
PRMT6; PRMT5; PRMT1; GRHL1; GRHL3; GRHL2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-GRHL3 (ARP39489_T100) antibody |
| Blocking Peptide |
For anti-GRHL3 (ARP39489_T100) antibody is Catalog # AAP39489 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3 |
| Uniprot ID |
Q8TE85 |
| Protein Name |
Grainyhead-like protein 3 homolog |
| Publications |
Lack of IRF6 Disrupts Human Epithelial Homeostasis by Altering Colony Morphology, Migration Pattern, and Differentiation Potential of Keratinocytes. Front Cell Dev Biol. 9, 718066 (2021) |
| Protein Accession # |
NP_067003 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021180 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GRHL3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Heart
 | Human Heart |
|
| Image 2 | Human Jurkat
 | WB Suggested Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat |
|
| Image 3 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. Multiple isoforms contain the peptide sequence, including 70 kDa and 57 kDa.
|
|
