GRHL3 Antibody - C-terminal region (ARP39489_P050)

• Product Number: ARP39489_P050
• Name: GRHL3 Antibody - C-terminal region (ARP39489_P050)
• Protein Size (# AA): 509 amino acids
• Molecular Weight: 57 kDa, 70 kDa
• NCBI Gene Id: 57822
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Grainyhead-like 3 (Drosophila)
• Alias Symbols: SOM, VWS2, TFCP2L4
• Peptide Sequence: Synthetic peptide located within the following region: EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ting,S.B., (2003) Biochem. J. 370 (PT 3), 953-962
• Description of Target: GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined.
• Protein Interactions: PRMT6; PRMT5; PRMT1; GRHL1; GRHL3; GRHL2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-GRHL3 (ARP39489_P050) antibody is Catalog # AAP39489 (Previous Catalog # AAPP21506)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3
• Uniprot ID: Q8TE85-4
• Protein Name: Grainyhead-like protein 3 homolog
• Publications:

  Sakurai, T. et al. Involvement of leucine zipper transcription factor-like protein 1 (Lztfl1) in the attenuation of cognitive impairment by exercise training. Biochem. Biophys. Res. Commun. 416, 125-9 (2011). 22094257

• Protein Accession #: NP_937817
• Purification: Affinity Purified
• Nucleotide Accession #: NM_198174
• Tested Species Reactivity: Human
• Gene Symbol: GRHL3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB, ChIP
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%
• Image 1: Human Placenta
  
  Immunohistochemistry of formalin-fixed, paraffin-embedded Human Placenta tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
• Image 2: Western Blot
  
  25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. Several isoforms can be detected using this antibody including isoform 1 (70 kDa) and isoform 4 (57 kDa).