| Product Number |
ARP39473_T100 |
| Product Page |
www.avivasysbio.com/lzts1-antibody-c-terminal-region-arp39473-t100.html |
| Name |
LZTS1 Antibody - C-terminal region (ARP39473_T100) |
| Protein Size (# AA) |
596 amino acids |
| Molecular Weight |
67kDa |
| NCBI Gene Id |
11178 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Leucine zipper, putative tumor suppressor 1 |
| Alias Symbols |
F37, FEZ1 |
| Peptide Sequence |
Synthetic peptide located within the following region: QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hawkins,G.A., et al., (2002) Cancer Genet. Cytogenet. 137 (1), 1-7 |
| Description of Target |
LZTS1 involved in the regulation of cell growth. LZTS1 may stabilize the active CDC2-cyclin B1 complex and thereby contribute to the regulation of the cell cycle and the prevention of uncontrolled cell proliferation. LZTS1 may act as tumor suppressor and defects in LZTS1 are found in many types of tumors. |
| Protein Interactions |
EEF1G; CDC25C; CDK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LZTS1 (ARP39473_T100) antibody |
| Blocking Peptide |
For anti-LZTS1 (ARP39473_T100) antibody is Catalog # AAP39473 (Previous Catalog # AAPP21487) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LZTS1 |
| Uniprot ID |
Q9Y250 |
| Protein Name |
Leucine zipper putative tumor suppressor 1 |
| Protein Accession # |
NP_066300 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021020 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LZTS1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-LZTS1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
