ZNF286 Antibody - C-terminal region (ARP39424_T100)

• Product Number: ARP39424_T100
• Name: ZNF286 Antibody - C-terminal region (ARP39424_T100)
• Protein Size (# AA): 521 amino acids
• Molecular Weight: 60kDa
• NCBI Gene Id: 57335
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 286A
• Alias Symbols: ZNF286
• Peptide Sequence: Synthetic peptide located within the following region: GKAFIHSSALIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: ZNF286 may be involved in transcriptional regulation.
• Protein Interactions: KRTAP10-5; KRTAP10-1; KRT40;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF286A (ARP39424_T100) antibody is Catalog # AAP39424 (Previous Catalog # AAPP21439)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF286
• Uniprot ID: Q9HBT8
• Protein Name: Zinc finger protein 286A
• Sample Type Confirmation:

  ZNF286A is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_065703
• Purification: Protein A purified
• Nucleotide Accession #: NM_020652
• Tested Species Reactivity: Human
• Gene Symbol: ZNF286A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF286 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysateZNF286A is supported by BioGPS gene expression data to be expressed in Jurkat