Product Number |
ARP39415_T100 |
Product Page |
www.avivasysbio.com/rexo4-antibody-n-terminal-region-arp39415-t100.html |
Name |
REXO4 Antibody - N-terminal region (ARP39415_T100) |
Protein Size (# AA) |
422 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
57109 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
REX4, RNA exonuclease 4 homolog (S. cerevisiae) |
Alias Symbols |
REX4, XPMC2, XPMC2H |
Peptide Sequence |
Synthetic peptide located within the following region: MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Montano,M.M., (2000) J. Biol. Chem. 275 (44), 34306-34313 |
Description of Target |
The regulation of the quinone reductase (QR) gene as well as other genes involved in detoxification is known to be mediated by an electrophile response element (EpRE). QR gene regulation by the antiestrogen-occupied estrogen receptor (ER) is mediated by the EpRE-containing region of the human QR gene, and the ER is one of the complex of proteins that binds to the EpRE. REXO4 directly binds to the EpRE and interacts with the ER. The activation of QR gene activity by REXO4 is enhanced in the presence of ER beta. |
Protein Interactions |
UBC; SIRT7; ESR2; ESR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-REXO4 (ARP39415_T100) antibody |
Blocking Peptide |
For anti-REXO4 (ARP39415_T100) antibody is Catalog # AAP39415 (Previous Catalog # AAPP21430) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human REXO4 |
Uniprot ID |
Q9GZR2 |
Protein Name |
RNA exonuclease 4 |
Protein Accession # |
NP_065118 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_020385 |
Tested Species Reactivity |
Human |
Gene Symbol |
REXO4 |
Predicted Species Reactivity |
Human, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rat: 79% |
Image 1 | Human Jurkat
| WB Suggested Anti-REXO4 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|