| Product Number |
ARP39390_T100 |
| Product Page |
www.avivasysbio.com/mettl3-antibody-n-terminal-region-arp39390-t100.html |
| Name |
METTL3 Antibody - N-terminal region (ARP39390_T100) |
| Protein Size (# AA) |
580 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
56339 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Methyltransferase like 3 |
| Description |
|
| Alias Symbols |
M6A, IME4, Spo8, MT-A70, hMETTL3 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bujnicki,J.M., (2002) J. Mol. Evol. 55 (4), 431-444 |
| Description of Target |
METTL3 is the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine. |
| Protein Interactions |
UBC; METTL14; UBD; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-METTL3 (ARP39390_T100) antibody |
| Blocking Peptide |
For anti-METTL3 (ARP39390_T100) antibody is Catalog # AAP39390 (Previous Catalog # AAPP21405) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human METTL3 |
| Uniprot ID |
Q86U44 |
| Protein Name |
N6-adenosine-methyltransferase 70 kDa subunit |
| Publications |
N6-Adenosine Methylation of Socs1 mRNA Is Required to Sustain the Negative Feedback Control of Macrophage Activation. Dev Cell. 55, 737-753.e7 (2020). 33220174 |
| Protein Accession # |
NP_062826 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_019852 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
METTL3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | HepG2 Cell Lysate, Human Liver Tumor
 | Host: Rabbit
Target: METTL3
Positive control (+): HepG2 Cell Lysate (HG)
Negative control (-): Human Liver Tumor (T-LI)
Antibody concentration: 1ug/ml |
|
| Image 2 | Human Intestine
 | Human Intestine |
|
| Image 3 | Human Thymus
 | WB Suggested Anti-METTL3 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus |
|
