Product Number |
ARP39385_T100 |
Product Page |
www.avivasysbio.com/znf307-antibody-c-terminal-region-arp39385-t100.html |
Name |
ZNF307 Antibody - C-terminal region (ARP39385_T100) |
Protein Size (# AA) |
545 amino acids |
Molecular Weight |
62kDa |
NCBI Gene Id |
387032 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger with KRAB and SCAN domains 4 |
Alias Symbols |
ZNF307, ZNF427, ZSCAN36, P1P373C6 |
Peptide Sequence |
Synthetic peptide located within the following region: FTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota T, (2004) Nat Genet. 36(1):40-5 |
Description of Target |
ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Protein Interactions |
ZKSCAN4; ZNF496; LXN; TRIM39; CABP5; ZKSCAN7; ZSCAN32; SCAND1; TERF2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZKSCAN4 (ARP39385_T100) antibody |
Blocking Peptide |
For anti-ZKSCAN4 (ARP39385_T100) antibody is Catalog # AAP39385 (Previous Catalog # AAPP21396) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF307 |
Uniprot ID |
Q969J2 |
Protein Name |
Zinc finger protein with KRAB and SCAN domains 4 |
Publications |
ZNF307 (Zinc Finger Protein 307) Acts as a Negative Regulator of Pressure Overload-Induced Cardiac Hypertrophy. Hypertension. 69, 615-624 (2017). 28223477 |
Protein Accession # |
NP_061983 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_019110 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZKSCAN4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 92%; Rabbit: 79%; Rat: 100% |
Image 1 | Transfected 293T
| WB Suggested Anti-ZNF307 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T |
|