| Product Number |
ARP39361_P050 |
| Product Page |
www.avivasysbio.com/mds032-antibody-n-terminal-region-arp39361-p050.html |
| Name |
MDS032 Antibody - N-terminal region (ARP39361_P050) |
| Protein Size (# AA) |
259 amino acids |
| Molecular Weight |
29kDa |
| NCBI Gene Id |
55850 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Unconventional SNARE in the ER 1 homolog (S. cerevisiae) |
| Description |
|
| Alias Symbols |
D12, P31, SLT1, MDS032 |
| Peptide Sequence |
Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Matsuda,A., (2003) Oncogene 22 (21), 3307-3318 |
| Description of Target |
MDS032 belongs to the USE1 family and is a component of a SNARE complex which may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. |
| Protein Interactions |
TRIM27; MEOX2; APP; UBC; BSCL2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-USE1 (ARP39361_P050) antibody |
| Blocking Peptide |
For anti-USE1 (ARP39361_P050) antibody is Catalog # AAP39361 (Previous Catalog # AAPP21373) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MDS032 |
| Uniprot ID |
Q9NZ43 |
| Protein Name |
Vesicle transport protein USE1 |
| Publications |
Serologic markers of effective tumor immunity against chronic lymphocytic leukemia include nonmutated B-cell antigens. Cancer Res. 70, 1344-55 (2010). 20124481 |
| Sample Type Confirmation |
USE1 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_060937 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018467 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
USE1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Yeast, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Yeast: 100%; Zebrafish: 77% |
| Image 1 | Human Intestine
 | Human Intestine |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-MDS032 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateUSE1 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
