| Product Number |
ARP39348_T100 |
| Product Page |
www.avivasysbio.com/znf444-antibody-c-terminal-region-arp39348-t100.html |
| Name |
ZNF444 Antibody - C-terminal region (ARP39348_T100) |
| Protein Size (# AA) |
327 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
55311 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 444 |
| Alias Symbols |
EZF2, EZF-2, ZSCAN17 |
| Peptide Sequence |
Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Adachi,H., et al., (2002) J. Biol. Chem. 277 (27), 24014-24021 |
| Description of Target |
ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, which strongly suggested that ZNF444 is a transcriptional regulator.ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM]. |
| Protein Interactions |
SRPK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF444 (ARP39348_T100) antibody |
| Blocking Peptide |
For anti-ZNF444 (ARP39348_T100) antibody is Catalog # AAP39348 (Previous Catalog # AAPP21360) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF444 |
| Uniprot ID |
Q8N0Y2 |
| Protein Name |
Zinc finger protein 444 |
| Sample Type Confirmation |
ZNF444 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_060807 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_018337 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF444 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF444 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateZNF444 is supported by BioGPS gene expression data to be expressed in Jurkat |
| | Image 2 | Human Lung
 | Rabbit Anti-ZNF444 antibody
Catalog Number: ARP39348_T100
Paraffin Embedded Tissue: Human Lung cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
|
