| Product Number |
ARP39346_T100 |
| Product Page |
www.avivasysbio.com/klhl26-antibody-c-terminal-region-arp39346-t100.html |
| Name |
KLHL26 Antibody - C-terminal region (ARP39346_T100) |
| Protein Size (# AA) |
615 amino acids |
| Molecular Weight |
68kDa |
| NCBI Gene Id |
55295 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Kelch-like 26 (Drosophila) |
| Peptide Sequence |
Synthetic peptide located within the following region: EAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Suzuki,Y., Gene 200 (1-2), 149-156 (1997) |
| Description of Target |
The function of KLHL26 remains unknown. |
| Protein Interactions |
UBC; HSP90AA1; UBQLN4; DCUN1D1; COPS5; CUL3; ACIN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KLHL26 (ARP39346_T100) antibody |
| Blocking Peptide |
For anti-KLHL26 (ARP39346_T100) antibody is Catalog # AAP39346 (Previous Catalog # AAPP21358) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KLHL26 |
| Uniprot ID |
Q53HC5 |
| Protein Name |
Kelch-like protein 26 |
| Sample Type Confirmation |
KLHL26 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_060786 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_018316 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KLHL26 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 93% |
| Image 1 | Human Lung
 | Rabbit Anti-KLHL26 antibody
Catalog Number: ARP39346_T100
Paraffin Embedded Tissue: Human Lung cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-KLHL26 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateKLHL26 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
