TRIM62 Antibody - N-terminal region (ARP39341_T100)

• Product Number: ARP39341_T100
• Name: TRIM62 Antibody - N-terminal region (ARP39341_T100)
• Protein Size (# AA): 475 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 55223
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Tripartite motif containing 62
• Alias Symbols: DEAR1
• Peptide Sequence: Synthetic peptide located within the following region: CSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Isogai,T., et al., (2000) Unpublished
• Description of Target: TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.
• Protein Interactions: SMAD3; UBC; SKIL; SMAD2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TRIM62 (ARP39341_T100) antibody is Catalog # AAP39341 (Previous Catalog # AAPP21353)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM62
• Uniprot ID: Q9BVG3
• Protein Name: Tripartite motif-containing protein 62
• Protein Accession #: NP_060677
• Purification: Protein A purified
• Nucleotide Accession #: NM_018207
• Tested Species Reactivity: Human
• Gene Symbol: TRIM62
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
• Image 1: Human Ovary Tumor
  
  Host: Rabbit
  Target Name: TRIM62
  Sample Tissue: Human Ovary Tumor
  Antibody Dilution: 1.0ug/ml