ZFP64 Antibody - C-terminal region (ARP39338_T100)

Data Sheet
 
Product Number ARP39338_T100
Product Page www.avivasysbio.com/zfp64-antibody-c-terminal-region-arp39338-t100.html
Name ZFP64 Antibody - C-terminal region (ARP39338_T100)
Protein Size (# AA) 627 amino acids
Molecular Weight 69kDa
NCBI Gene Id 55734
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 64 homolog (mouse)
Alias Symbols ZNF338
Peptide Sequence Synthetic peptide located within the following region: SDGGQNIAVATTAPPVFSSSSQQELPKQTYSIIQGAAHPALLCPADSIPD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Description of Target ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regulation.
Protein Interactions MFAP1; LMO2; FHL2; BYSL; FAM124A; TRIM41; LNX1; AEN; PBK; RNF2; HECW2; BARD1; ZBTB9; PPARGC1B; ZNF513; MAFB; ZNF70; MTUS2; SETDB1; BEGAIN; C14orf1; UNC119; TLE1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZFP64 (ARP39338_T100) antibody
Blocking Peptide For anti-ZFP64 (ARP39338_T100) antibody is Catalog # AAP39338 (Previous Catalog # AAPP21350)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZFP64
Uniprot ID Q9NPA5-2
Protein Name Zinc finger protein 64 homolog, isoforms 1 and 2
Protein Accession # NP_071371
Purification Protein A purified
Nucleotide Accession # NM_022088
Tested Species Reactivity Human
Gene Symbol ZFP64
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 93%
Image 1
Transfected 293T
WB Suggested Anti-ZFP64 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com