| Product Number |
ARP39325_P050 |
| Product Page |
www.avivasysbio.com/jmjd2d-antibody-c-terminal-region-arp39325-p050.html |
| Name |
JMJD2D Antibody - C-terminal region (ARP39325_P050) |
| Protein Size (# AA) |
523 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
55693 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Lysine (K)-specific demethylase 4D |
| Alias Symbols |
JMJD2D |
| Peptide Sequence |
Synthetic peptide located within the following region: RAQELTLQTPAKRPLLAGTTCTASGPEPEPLPEDGALMDKPVPLSPGLQH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Katoh,M. (2004) Int. J. Oncol. 24 (6), 1623-1628 |
| Description of Target |
JMJD2D belongs to JMJD2 family that is consist of four cancer-associated genes |
| Protein Interactions |
HECW2; PPP1CC; CUL4B; TP53; AR; KDM4D; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KDM4D (ARP39325_P050) antibody |
| Blocking Peptide |
For anti-KDM4D (ARP39325_P050) antibody is Catalog # AAP39325 (Previous Catalog # AAPP23039) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD2D |
| Uniprot ID |
Q0VF39 |
| Protein Name |
Lysine-specific demethylase 4D |
| Protein Accession # |
NP_060509 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018039 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KDM4D |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human Intestine
 | Human Intestine |
| | Image 3 | Human brain
 | WB Suggested Anti-JMJD2D Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain |
|
|
