Product Number |
ARP39321_T100 |
Product Page |
www.avivasysbio.com/znf312-antibody-c-terminal-region-arp39321-t100.html |
Name |
ZNF312 Antibody - C-terminal region (ARP39321_T100) |
Protein Size (# AA) |
459 amino acids |
Molecular Weight |
50kDa |
NCBI Gene Id |
55079 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
FEZ family zinc finger 2 |
Alias Symbols |
FEZ, TOF, FEZL, FKSG36, ZFP312, ZNF312 |
Peptide Sequence |
Synthetic peptide located within the following region: THNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hashimoto,H., et al., (2000) Mech. Dev. 97 (1-2), 191-195 |
Description of Target |
ZNF312 is a candidate transcription factor. |
Protein Interactions |
HDAC1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FEZF2 (ARP39321_T100) antibody |
Blocking Peptide |
For anti-FEZF2 (ARP39321_T100) antibody is Catalog # AAP39321 (Previous Catalog # AAPP21333) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF312 |
Uniprot ID |
Q8TBJ5 |
Protein Name |
Fez family zinc finger protein 2 |
Sample Type Confirmation |
FEZF2 is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_060478 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_018008 |
Tested Species Reactivity |
Human |
Gene Symbol |
FEZF2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF312 Antibody Titration: 5.0ug/ml ELISA Titer: 1:1562500 Positive Control: HepG2 cell lysateFEZF2 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
|