ZNF312 Antibody - C-terminal region (ARP39321_T100)

Data Sheet
 
Product Number ARP39321_T100
Product Page www.avivasysbio.com/znf312-antibody-c-terminal-region-arp39321-t100.html
Name ZNF312 Antibody - C-terminal region (ARP39321_T100)
Protein Size (# AA) 459 amino acids
Molecular Weight 50kDa
NCBI Gene Id 55079
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name FEZ family zinc finger 2
Alias Symbols FEZ, TOF, FEZL, FKSG36, ZFP312, ZNF312
Peptide Sequence Synthetic peptide located within the following region: THNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hashimoto,H., et al., (2000) Mech. Dev. 97 (1-2), 191-195
Description of Target ZNF312 is a candidate transcription factor.
Protein Interactions HDAC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FEZF2 (ARP39321_T100) antibody
Blocking Peptide For anti-FEZF2 (ARP39321_T100) antibody is Catalog # AAP39321 (Previous Catalog # AAPP21333)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF312
Uniprot ID Q8TBJ5
Protein Name Fez family zinc finger protein 2
Sample Type Confirmation

FEZF2 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_060478
Purification Protein A purified
Nucleotide Accession # NM_018008
Tested Species Reactivity Human
Gene Symbol FEZF2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-ZNF312 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysateFEZF2 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com