ZNF446 Antibody - C-terminal region (ARP39319_T100)

Data Sheet
 
Product Number ARP39319_T100
Product Page www.avivasysbio.com/znf446-antibody-c-terminal-region-arp39319-t100.html
Name ZNF446 Antibody - C-terminal region (ARP39319_T100)
Protein Size (# AA) 450 amino acids
Molecular Weight 49kDa
NCBI Gene Id 55663
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 446
Alias Symbols ZSCAN30, ZSCAN52, ZKSCAN20
Peptide Sequence Synthetic peptide located within the following region: SYPCEECGCSFSWKSQLVIHRKSHTGQRRHFCSDCGRAFDWKSQLVIHRK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Liu,F., et al., (2005) Biochem. Biophys. Res. Commun. 333 (1), 5-13
Description of Target ZNF446 contains a KRAB and three C(2)H(2) zinc fingers. ZNF446 is a transcription repressor when fused to GAL4 DNA-binding domain and co-transfected with VP-16. Overexpression of ZNF446 in COS-7 cells inhibits the transcriptional activities of SRE and AP-1, suggesting that the ZNF446 protein may act as a transcriptional repressor in mitogen-activated protein kinase (MAPK) signaling pathway to mediate cellular functions.
Protein Interactions NOTCH2NL; KRTAP10-3; ZSCAN22; ZNF396; KRT40; ZNF496; PGBD1; LZTS2; ZNF397; ZSCAN16; ZKSCAN7; ZNF446; ZSCAN32; ZNF232; ZSCAN9; ZNF165; ZSCAN21; ZNF24; TRIM27; PIN1; DGCR6; ACTN2; FHL5; DGCR6L; SUFU; ZNF263;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF446 (ARP39319_T100) antibody
Blocking Peptide For anti-ZNF446 (ARP39319_T100) antibody is Catalog # AAP39319 (Previous Catalog # AAPP21331)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF446
Uniprot ID Q9NWS9
Protein Name Zinc finger protein 446
Protein Accession # NP_060378
Purification Protein A purified
Nucleotide Accession # NM_017908
Tested Species Reactivity Human
Gene Symbol ZNF446
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 75%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-ZNF446 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com