| Product Number |
ARP39285_P050 |
| Product Page |
www.avivasysbio.com/znf821-antibody-c-terminal-region-arp39285-p050.html |
| Name |
ZNF821 Antibody - C-terminal region (ARP39285_P050) |
| Protein Size (# AA) |
370 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
55565 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 821 |
| Peptide Sequence |
Synthetic peptide located within the following region: LRAQFGQDPSAMAALAAEMNFFQLPVSGVELDSQLLGKMAFEEQNSSSLH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
PIM2; CDCA7L; LURAP1; CCDC85B; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF821 (ARP39285_P050) antibody |
| Blocking Peptide |
For anti-ZNF821 (ARP39285_P050) antibody is Catalog # AAP39285 (Previous Catalog # AAPP23469) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LOC55565 |
| Uniprot ID |
O75541 |
| Protein Name |
Zinc finger protein 821 |
| Protein Accession # |
NP_060000 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017530 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF821 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF821 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
