KLHL3 Antibody - N-terminal region (ARP39276_T100)

Data Sheet
 
Product Number ARP39276_T100
Product Page www.avivasysbio.com/klhl3-antibody-n-terminal-region-arp39276-t100.html
Name KLHL3 Antibody - N-terminal region (ARP39276_T100)
Protein Size (# AA) 587 amino acids
Molecular Weight 65kDa
NCBI Gene Id 26249
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Kelch-like 3 (Drosophila)
Alias Symbols PHA2D
Peptide Sequence Synthetic peptide located within the following region: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lai,F., et al., (2000) Genomics 66 (1), 65-75
Description of Target KLHL3 protein contains a poxvirus and zinc finger domain at the N-terminus and six tandem repeats (kelch repeats) at the C-terminus. At the amino acid level, KLHL3 shares 77% similarity with Drosophila kelch and 89% similarity with Mayven (KLHL2), another human kelch homolog. At least three isoforms are produced and may be the result of alternative promoter usage. The KLHL3 maps within the smallest commonly deleted segment in myeloid leukemias characterized by a deletion of 5q; however, no inactivating mutations of KLHL3 could be detected in malignant myeloid disorders with loss of 5q.
Protein Interactions WNK4; KLHL12; KLHL3; KEAP1; MORF4L2; CUL3; UBC; C6orf165; WNK3; WNK2; WNK1; RBX1; SLC12A3; ELAVL1; SYNCRIP; SYT2; OPRD1; GNAO1; GNAI1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KLHL3 (ARP39276_T100) antibody
Blocking Peptide For anti-KLHL3 (ARP39276_T100) antibody is Catalog # AAP39276 (Previous Catalog # AAPY00886)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL3
Uniprot ID Q9UH77
Protein Name Kelch-like protein 3
Protein Accession # NP_059111
Purification Protein A purified
Nucleotide Accession # NM_017415
Tested Species Reactivity Human
Gene Symbol KLHL3
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 91%; Guinea Pig: 85%; Human: 100%; Rabbit: 100%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-KLHL3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
Human Ovary Tumor, Human Liver
Host: Rabbit
Target: KLHL3
Positive control (+): Human Ovary Tumor (T-OV)
Negative control (-): Human Liver (LI)
Antibody concentration: 0.5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com