HOXC10 Antibody - N-terminal region (ARP39274_P050)

Data Sheet
 
Product Number ARP39274_P050
Product Page www.avivasysbio.com/hoxc10-antibody-n-terminal-region-arp39274-p050.html
Name HOXC10 Antibody - N-terminal region (ARP39274_P050)
Protein Size (# AA) 342 amino acids
Molecular Weight 38kDa
NCBI Gene Id 3226
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox C10
Alias Symbols HOX3I
Peptide Sequence Synthetic peptide located within the following region: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gabellini,D., (2003) EMBO J. 22 (14), 3715-3724
Description of Target HOXC10 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.
Protein Interactions EGFR; UBC; NUP205; YWHAG; CWC27; SUMO2; CDC27;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXC10 (ARP39274_P050) antibody
Blocking Peptide For anti-HOXC10 (ARP39274_P050) antibody is Catalog # AAP39274 (Previous Catalog # AAPY00884)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC10
Uniprot ID Q9NYD6
Protein Name Homeobox protein Hox-C10
Protein Accession # NP_059105
Purification Affinity Purified
Nucleotide Accession # NM_017409
Tested Species Reactivity Human
Gene Symbol HOXC10
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Lung
Human Lung
Image 2
Transfected 293T
WB Suggested Anti-HOXC10 Antibody Titration: 0.0625ug/ml
ELISA Titer: 1:12500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com