Product Number |
ARP39274_P050 |
Product Page |
www.avivasysbio.com/hoxc10-antibody-n-terminal-region-arp39274-p050.html |
Name |
HOXC10 Antibody - N-terminal region (ARP39274_P050) |
Protein Size (# AA) |
342 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
3226 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Homeobox C10 |
Alias Symbols |
HOX3I |
Peptide Sequence |
Synthetic peptide located within the following region: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gabellini,D., (2003) EMBO J. 22 (14), 3715-3724 |
Description of Target |
HOXC10 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation. |
Protein Interactions |
EGFR; UBC; NUP205; YWHAG; CWC27; SUMO2; CDC27; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HOXC10 (ARP39274_P050) antibody |
Blocking Peptide |
For anti-HOXC10 (ARP39274_P050) antibody is Catalog # AAP39274 (Previous Catalog # AAPY00884) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC10 |
Uniprot ID |
Q9NYD6 |
Protein Name |
Homeobox protein Hox-C10 |
Protein Accession # |
NP_059105 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017409 |
Tested Species Reactivity |
Human |
Gene Symbol |
HOXC10 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Lung
| Human Lung |
| Image 2 | Transfected 293T
| WB Suggested Anti-HOXC10 Antibody Titration: 0.0625ug/ml ELISA Titer: 1:12500 Positive Control: Transfected 293T |
|
|