JMJD1B Antibody - C-terminal region (ARP39268_T100)

Data Sheet
 
Product Number ARP39268_T100
Product Page www.avivasysbio.com/jmjd1b-antibody-c-terminal-region-arp39268-t100.html
Name JMJD1B Antibody - C-terminal region (ARP39268_T100)
Protein Size (# AA) 1761 amino acids
Molecular Weight 192kDa
NCBI Gene Id 51780
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Lysine (K)-specific demethylase 3B
Alias Symbols 5qNCA, DIJOS, NET22, C5orf7, JMJD1B
Peptide Sequence Synthetic peptide located within the following region: VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNII
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hu,Z., (2001) Oncogene 20 (47), 6946-6954
Description of Target JMJD1B contains a highly-conserved C-terminus containing a zinc finger with the unique spacing Cys-X2-Cys-X7-His-X2-Cys-X2-Cys-X4-Cys-X2-Cys and a jmjC domain. It plays an important role in histone demethylation and may be a candidate for tumor suppressors.
Protein Interactions UBC; WWOX; SPAG8; NCS1; SRP68; ZNF512B; VCP; HIST3H3; CREBBP; ELAVL1; SUMO2; ESRRA; USP18;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KDM3B (ARP39268_T100) antibody
Blocking Peptide For anti-KDM3B (ARP39268_T100) antibody is Catalog # AAP39268 (Previous Catalog # AAPY00878)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1B
Uniprot ID Q7LBC6
Protein Name Lysine-specific demethylase 3B
Protein Accession # NP_057688
Purification Protein A purified
Nucleotide Accession # NM_016604
Tested Species Reactivity Human
Gene Symbol KDM3B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Thymus
WB Suggested Anti-JMJD1B Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: Human Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com