| Product Number |
ARP39265_T100 |
| Product Page |
www.avivasysbio.com/ergic2-antibody-n-terminal-region-arp39265-t100.html |
| Name |
ERGIC2 Antibody - N-terminal region (ARP39265_T100) |
| Protein Size (# AA) |
377 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
51290 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
ERGIC and golgi 2 |
| Alias Symbols |
PTX1, CDA14, Erv41, cd002 |
| Peptide Sequence |
Synthetic peptide located within the following region: MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Breuza,L., (2004) J. Biol. Chem. 279 (45), 47242-47253 |
| Description of Target |
ERGIon Channel2 possibly play role in transport between endoplasmic reticulum and Golgi. ERGIon Channel2 is downregulated in prostate cancer. ERGIon Channel2 may play an important role in the growth and tumorigenicity of PC-3 prostate tumor cells. Ectopic expression of a partial sequence of ERGIon Channel2 as a VP22-fusion protein in prostate cancer cell line, PC-3, induced cellular senescence. Interferon-beta (IFN-beta) and a number of IFN-inducible genes were upregulated by the ERGIon Channel2-VP22 fusion protein. |
| Protein Interactions |
env; UBC; Copa; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ERGIC2 (ARP39265_T100) antibody |
| Blocking Peptide |
For anti-ERGIC2 (ARP39265_T100) antibody is Catalog # AAP39265 (Previous Catalog # AAPY00875) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ERGIC2 |
| Uniprot ID |
Q96RQ1 |
| Protein Name |
Endoplasmic reticulum-Golgi intermediate compartment protein 2 |
| Protein Accession # |
NP_057654 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_016570 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ERGIC2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ERGIC2 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
|
