| Product Number |
ARP39264_P050 |
| Product Page |
www.avivasysbio.com/klf3-antibody-c-terminal-region-arp39264-p050.html |
| Name |
Klf3 Antibody - C-terminal region (ARP39264_P050) |
| Protein Size (# AA) |
344 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
114845 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Kruppel-like factor 3 (basic) |
| Alias Symbols |
Bklf, Tef-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
human homolog is a transcription factor; involved in haematopoietic differentiation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Klf3 (ARP39264_P050) antibody |
| Blocking Peptide |
For anti-Klf3 (ARP39264_P050) antibody is Catalog # AAP39264 (Previous Catalog # AAPY00874) |
| Uniprot ID |
D4A4V3 |
| Protein Name |
Kruppel-like factor 3 (Basic) (Mapped), isoform CRA_b EMBL EDL90083.1 |
| Protein Accession # |
NP_001099212 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001105742 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Klf3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Klf3 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
|
|
