| Product Number |
ARP39236_P050 |
| Product Page |
www.avivasysbio.com/znf580-antibody-n-terminal-region-arp39236-p050.html |
| Name |
ZNF580 Antibody - N-terminal region (ARP39236_P050) |
| Protein Size (# AA) |
172 amino acids |
| Molecular Weight |
19kDa |
| NCBI Gene Id |
51157 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 580 |
| Description |
|
| Peptide Sequence |
Synthetic peptide located within the following region: KAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQRE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZNF580 may be involved in transcriptional regulation. |
| Protein Interactions |
ARHGEF6; SH3GL2; XBP1; PAX9; TSC22D4; RAD54B; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF580 (ARP39236_P050) antibody |
| Blocking Peptide |
For anti-ZNF580 (ARP39236_P050) antibody is Catalog # AAP39236 (Previous Catalog # AAPY00848) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF580 |
| Uniprot ID |
Q9UK33 |
| Protein Name |
Zinc finger protein 580 |
| Publications |
Hoffmann, C. J. et al. Suppression of zinc finger protein 580 by high oxLDL/LDL-ratios is followed by enhanced expression of endothelial IL-8. Atherosclerosis 216, 103-8 (2011). 21310414
ZNF580 - a brake on Interleukin-6. J Inflamm (Lond). 15, 20 (2018). 30386182 |
| Protein Accession # |
NP_057286 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016202 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF580 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF580 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Stomach
 | Human Stomach |
|
| Image 3 | RPMI-8226, U937
 | Host: Rabbit
Target: ZNF580
Positive control (+): RPMI-8226 (N12)
Negative control (-): U937 (N31)
Antibody concentration: 3ug/ml |
|
