website statistics
Product Datasheet: ARP39236_P050 - ZNF580 antibody - N-terminal region (ARP39236_P050) - Aviva Systems Biology
 
ZNF580 antibody - N-terminal region (ARP39236_P050)
Data Sheet
 
Product Number ARP39236_P050
Product Page www.avivasysbio.com/znf580-antibody-n-terminal-region-arp39236-p050.html
Product Name ZNF580 antibody - N-terminal region (ARP39236_P050)
Size 100 ul
Gene Symbol ZNF580
Protein Size (# AA) 172 amino acids
Molecular Weight 19kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 51157
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 580
Description This is a rabbit polyclonal antibody against ZNF580. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: KAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQRE
Description of Target ZNF580 may be involved in transcriptional regulation.
Protein Interactions ARHGEF6; SH3GL2; XBP1; PAX9; TSC22D4; RAD54B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZNF580 (ARP39236_P050) antibody is Catalog # AAP39236 (Previous Catalog # AAPY00848)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF580
Complete computational species homology data Anti-ZNF580 (ARP39236_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF580.
Swissprot Id Q9UK33
Protein Name Zinc finger protein 580
Publications

Hoffmann, C. J. et al. Suppression of zinc finger protein 580 by high oxLDL/LDL-ratios is followed by enhanced expression of endothelial IL-8. Atherosclerosis 216, 103-8 (2011). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat 21310414

Protein Accession # NP_057286
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF580.
Nucleotide Accession # NM_016202
Replacement Item This antibody may replace item sc-102247 from Santa Cruz Biotechnology.
Conjugation Options

ARP39236_P050-FITC Conjugated

ARP39236_P050-HRP Conjugated

ARP39236_P050-Biotin Conjugated

CB Replacement sc-102247; sc-97913
Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 93%
Image 1
Human Stomach
Human Stomach
Image 2
Human Jurkat
WB Suggested Anti-ZNF580 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com