TLX2 Antibody - C-terminal region (ARP39235_T100)

• Product Number: ARP39235_T100
• Name: TLX2 Antibody - C-terminal region (ARP39235_T100)
• Protein Size (# AA): 284 amino acids
• Molecular Weight: 30kDa
• NCBI Gene Id: 3196
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: T-cell leukemia homeobox 2
• Alias Symbols: NCX, HOX11L1
• Peptide Sequence: Synthetic peptide located within the following region: QQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Borghini,S., (2006) Biochem. J. 395 (2), 355-361
• Description of Target: TLX2 contains 1 homeobox DNA-binding domain and the function remains unknown.
• Protein Interactions: ZNF502; GTF2A1L; IRF9; TLE1; POU2F1; MEIS1; MCM4; IRF6; YWHAH;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TLX2 (ARP39235_T100) antibody is Catalog # AAP39235 (Previous Catalog # AAPY00847)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TLX2
• Uniprot ID: O43763
• Protein Name: T-cell leukemia homeobox protein 2
• Protein Accession #: NP_057254
• Purification: Protein A purified
• Nucleotide Accession #: NM_016170
• Tested Species Reactivity: Human
• Gene Symbol: TLX2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Muscle
  
  Human Muscle
• Image 2: Human HepG2
  
  WB Suggested Anti-TLX2 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate