Zfr Antibody - N-terminal region (ARP39226_P050)

• Product Number: ARP39226_P050
• Name: Zfr Antibody - N-terminal region (ARP39226_P050)
• Protein Size (# AA): 1052 amino acids
• Molecular Weight: 114kDa
• NCBI Gene Id: 22763
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger RNA binding protein
• Alias Symbols: C920030H05Rik
• Peptide Sequence: Synthetic peptide located within the following region: ICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAAAAAAQYSQQPASGV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of this protein remains unknown.
• Protein Interactions: Eed; Nanog;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Zfr (ARP39226_P050) antibody is Catalog # AAP39226 (Previous Catalog # AAPY00838)
• Uniprot ID: B2RUG7
• Protein Name: Zinc finger RNA binding protein EMBL AAI41140.1
• Protein Accession #: NP_035897
• Purification: Affinity Purified
• Nucleotide Accession #: NM_011767
• Tested Species Reactivity: Mouse
• Gene Symbol: Zfr
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Rabbit, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Mouse Liver
  
  WB Suggested Anti-Zfr Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Liver
• Image 2: heart
  
  Rabbit Anti-Zfr Antibody
  Catalog Number: ARP39226_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy2/3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.