ZNF777 Antibody - C-terminal region (ARP39206_P050)

Data Sheet
 
Product Number ARP39206_P050
Product Page www.avivasysbio.com/znf777-antibody-c-terminal-region-arp39206-p050.html
Name ZNF777 Antibody - C-terminal region (ARP39206_P050)
Protein Size (# AA) 524 amino acids
Molecular Weight 58kDa
NCBI Gene Id 27153
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 777
Peptide Sequence Synthetic peptide located within the following region: GGGRGPGEPFRAVNFLDNKMDETNQHGGRDLAAGHSEGRCRAHLVGDRTL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nagase T, (1999) DNA Res. 1999 Oct 29;6(5):337-45.
Description of Target The function remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF777 (ARP39206_P050) antibody
Blocking Peptide For anti-ZNF777 (ARP39206_P050) antibody is Catalog # AAP39206 (Previous Catalog # AAPP22976)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF777
Uniprot ID Q8N2J5
Protein Name cDNA FLJ90551 fis, clone OVARC1000779, weakly similar to ZINC FINGER PROTEIN 157 EMBL BAC11364.1
Protein Accession # EAL24432
Purification Affinity Purified
Nucleotide Accession # NM_015694
Tested Species Reactivity Human
Gene Symbol ZNF777
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZNF777 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com