Product Number |
ARP39206_P050 |
Product Page |
www.avivasysbio.com/znf777-antibody-c-terminal-region-arp39206-p050.html |
Name |
ZNF777 Antibody - C-terminal region (ARP39206_P050) |
Protein Size (# AA) |
524 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
27153 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 777 |
Peptide Sequence |
Synthetic peptide located within the following region: GGGRGPGEPFRAVNFLDNKMDETNQHGGRDLAAGHSEGRCRAHLVGDRTL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Nagase T, (1999) DNA Res. 1999 Oct 29;6(5):337-45. |
Description of Target |
The function remains unknown. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF777 (ARP39206_P050) antibody |
Blocking Peptide |
For anti-ZNF777 (ARP39206_P050) antibody is Catalog # AAP39206 (Previous Catalog # AAPP22976) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF777 |
Uniprot ID |
Q8N2J5 |
Protein Name |
cDNA FLJ90551 fis, clone OVARC1000779, weakly similar to ZINC FINGER PROTEIN 157 EMBL BAC11364.1 |
Protein Accession # |
EAL24432 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015694 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF777 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF777 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|