ZNF777 Antibody - N-terminal region (ARP39205_P050)

Data Sheet
 
Product Number ARP39205_P050
Product Page www.avivasysbio.com/znf777-antibody-n-terminal-region-arp39205-p050.html
Name ZNF777 Antibody - N-terminal region (ARP39205_P050)
Protein Size (# AA) 578 amino acids
Molecular Weight 62kDa
NCBI Gene Id 27153
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 777
Peptide Sequence Synthetic peptide located within the following region: ENLLKNRNFWILRLPPGSNGEVPKVPVTFDDVAVHFSEQEWGNLSEWQKE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF777 (ARP39205_P050) antibody
Blocking Peptide For anti-ZNF777 (ARP39205_P050) antibody is Catalog # AAP39205 (Previous Catalog # AAPY00817)
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human ZNF777
Uniprot ID Q3KR11
Protein Name ZNF777 protein EMBL AAI05969.1
Protein Accession # AAI05969
Purification Affinity Purified
Nucleotide Accession # NM_015694
Tested Species Reactivity Human
Gene Symbol ZNF777
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human 721_B
WB Suggested Anti-ZNF777 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com