RCOR1 Antibody - C-terminal region (ARP39179_P050)

Data Sheet
 
Product Number ARP39179_P050
Product Page www.avivasysbio.com/rcor1-antibody-c-terminal-region-arp39179-p050.html
Name RCOR1 Antibody - C-terminal region (ARP39179_P050)
Protein Size (# AA) 482 amino acids
Molecular Weight 53kDa
NCBI Gene Id 23186
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name REST corepressor 1
Alias Symbols RCOR, COREST
Peptide Sequence Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Battaglioli,E., (2002) J. Biol. Chem. 277 (43), 41038-41045
Description of Target RCOR1 is a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.[supplied by OMIM].
Protein Interactions HDAC1; UBC; KDM1A; HDAC2; HDAC3; NPM1; MTA3; TP53BP1; NR2C1; TCF3; HMG20B; RCOR1; SNAI1; SUMO2; Dynll1; HIST3H3; TAL1; GFI1; GFI1B; MED28; OBFC1; SUB1; MED12; TRIP4; BCL3; ESCO2; SERPINH1; ZNF217; EMD; CTBP1; RL2; NR2E1; REST; HIST1H3A; SMARCE1; SMARCC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RCOR1 (ARP39179_P050) antibody
Blocking Peptide For anti-RCOR1 (ARP39179_P050) antibody is Catalog # AAP39179 (Previous Catalog # AAPP21284)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RCOR1
Uniprot ID Q9UKL0
Protein Name REST corepressor 1
Sample Type Confirmation

RCOR1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_055971
Purification Affinity Purified
Nucleotide Accession # NM_015156
Tested Species Reactivity Human
Gene Symbol RCOR1
Predicted Species Reactivity Human, Mouse, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Mouse: 79%
Image 1
Human Jurkat
WB Suggested Anti-RCOR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysateRCOR1 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com