HIC2 Antibody - N-terminal region (ARP39170_P050)

• Product Number: ARP39170_P050
• Name: HIC2 Antibody - N-terminal region (ARP39170_P050)
• Protein Size (# AA): 615 amino acids
• Molecular Weight: 66kDa
• NCBI Gene Id: 23119
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hypermethylated in cancer 2
• Alias Symbols: HRG22, ZBTB30, ZNF907
• Peptide Sequence: Synthetic peptide located within the following region: MVSGPLALRWCAWAGRGDMGPDMELPSHSKQLLLQLNQQRTKGFLCDVII
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Collins,J.E., Genome Biol. 5 (10), R84 (2004)
• Description of Target: HIon Channel2 contains 5 C2H2-type zinc fingers and 1 BTB (POZ) domain. It belongs to the krueppel C2H2-type zinc-finger protein family, Hic subfamily and is a transcriptional repressor.
• Protein Interactions: HIC2; HIC1; BARD1; LIG4; APP; PDK2; CCNT1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HIC2 (ARP39170_P050) antibody is Catalog # AAP39170 (Previous Catalog # AAPP21277)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HIC2
• Uniprot ID: Q96JB3
• Protein Name: Hypermethylated in cancer 2 protein
• Protein Accession #: NP_055909
• Purification: Affinity Purified
• Nucleotide Accession #: NM_015094
• Tested Species Reactivity: Human
• Gene Symbol: HIC2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Placenta
  
  WB Suggested Anti-HIC2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Placenta