| Product Number |
ARP39165_T100 |
| Product Page |
www.avivasysbio.com/trim35-antibody-c-terminal-region-arp39165-t100.html |
| Name |
TRIM35 Antibody - C-terminal region (ARP39165_T100) |
| Protein Size (# AA) |
493 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
23087 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Tripartite motif containing 35 |
| Alias Symbols |
HLS5, MAIR |
| Peptide Sequence |
Synthetic peptide located within the following region: RTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lalonde,J.P., (2004) J. Biol. Chem. 279 (9), 8181-8189 |
| Description of Target |
TRIM35 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM35 may play a role as a tumor suppressor, and is implicated in the cell death mechanism |
| Protein Interactions |
USP49; PAN2; USP2; TRIM5; TRIM11; UBE2U; UBE2W; UBE2D4; UBE2D3; UBE2D2; UBE2D1; TSG101; UBE2K; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRIM35 (ARP39165_T100) antibody |
| Blocking Peptide |
For anti-TRIM35 (ARP39165_T100) antibody is Catalog # AAP39165 (Previous Catalog # AAPS05501) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM35 |
| Uniprot ID |
Q9UPQ4 |
| Protein Name |
Tripartite motif-containing protein 35 |
| Protein Accession # |
NP_055881 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_015066 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRIM35 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Yeast: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TRIM35 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
