BTBD3 Antibody - C-terminal region (ARP39160_T100)

• Product Number: ARP39160_T100
• Name: BTBD3 Antibody - C-terminal region (ARP39160_T100)
• Protein Size (# AA): 522 amino acids
• Molecular Weight: 58kDa
• NCBI Gene Id: 22903
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: BTB (POZ) domain containing 3
• Alias Symbols: dJ742J24.1
• Peptide Sequence: Synthetic peptide located within the following region: PVQIEPDTFYTASVILDGNELSYFGQEGMTEVQCGKVTVQFQCSSDSTNG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: BTBD3 is a protein containing BTB/POZ domain. Its function has not been determined yet.
• Protein Interactions: UBC; ELAVL1; PLXNB3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-BTBD3 (ARP39160_T100) antibody is Catalog # AAP39160 (Previous Catalog # AAPP21268)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD3
• Uniprot ID: Q9Y2F9
• Protein Name: BTB/POZ domain-containing protein 3
• Protein Accession #: NP_055777
• Purification: Protein A purified
• Nucleotide Accession #: NM_014962
• Tested Species Reactivity: Human
• Gene Symbol: BTBD3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Placenta
  
  WB Suggested Anti-BTBD3 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Placenta