| Product Number |
ARP39137_P050 |
| Product Page |
www.avivasysbio.com/tsc22d2-antibody-n-terminal-region-arp39137-p050.html |
| Name |
TSC22D2 Antibody - N-terminal region (ARP39137_P050) |
| Protein Size (# AA) |
780 amino acids |
| Molecular Weight |
79kDa |
| NCBI Gene Id |
9819 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TSC22 domain family, member 2 |
| Alias Symbols |
TILZ4a, TILZ4b, TILZ4c |
| Peptide Sequence |
Synthetic peptide located within the following region: CFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Prasad,K. Unpublished (2003) |
| Description of Target |
TSC22D2 belongs to the TSC-22/Dip/Bun family and the function remains unknown. |
| Protein Interactions |
UBC; KEAP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TSC22D2 (ARP39137_P050) antibody |
| Blocking Peptide |
For anti-TSC22D2 (ARP39137_P050) antibody is Catalog # AAP39137 (Previous Catalog # AAPP21246) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TSC22D2 |
| Uniprot ID |
O75157 |
| Protein Name |
TSC22 domain family protein 2 |
| Protein Accession # |
NP_055594 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014779 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TSC22D2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 87% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TSC22D2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human Brain, Cortex
 | Rabbit Anti-TSC22D2 antibody
Catalog Number: ARP39137
Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
|
|
| Image 3 | Human Placenta
 | Rabbit Anti-TSC22D2 antibody
Catalog Number: ARP39137
Formalin Fixed Paraffin Embedded Tissue: Human Placenta
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
|
|
