SART3 antibody - N-terminal region (ARP39128_T100)
Data Sheet
Product Number ARP39128_T100
Product Page
Product Name SART3 antibody - N-terminal region (ARP39128_T100)
Size 100 ul
Gene Symbol SART3
Alias Symbols P100, p110, DSAP1, TIP110, p110(nrb), RP11-13G14
Protein Size (# AA) 364 amino acids
Molecular Weight 40kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 9733
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Squamous cell carcinoma antigen recognized by T cells 3
Description This is a rabbit polyclonal antibody against SART3. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: TSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWD
Target Reference Liu,Y.,(2002) J. Biol. Chem. 277 (26), 23854-23863
Description of Target SART3 is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. SART3 is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This protein is thought to be involved in the regulation of mRNA splicing.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SART3 (ARP39128_T100) antibody is Catalog # AAP39128 (Previous Catalog # AAPP21237)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SART3
Complete computational species homology data Anti-SART3 (ARP39128_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SART3.
Swissprot Id Q15020-2
Protein Name Squamous cell carcinoma antigen recognized by T-cells 3

Kaji, K; Mizukoshi, E; Yamashita, T; Arai, K; Sunagozaka, H; Fushimi, K; Nakagawa, H; Yamada, K; Terashima, T; Kitahara, M; Kaneko, S; Cellular Immune Responses for Squamous Cell Carcinoma Antigen Recognized by T Cells 3 in Patients with Hepatocellular Carcinoma. 12, e0170291 (2017). IHC, WB, Dog, Guinea Pig, Horse, Human, Pig, Rat 28114424

Sample Type Confirmation

SART3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # AAK69347
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SART3.
Nucleotide Accession # NM_014706
Replacement Item This antibody may replace item sc-244068 from Santa Cruz Biotechnology.
Conjugation Options

ARP39128_T100-FITC Conjugated

ARP39128_T100-HRP Conjugated

ARP39128_T100-Biotin Conjugated

CB Replacement sc-244068
Species Reactivity Dog, Guinea Pig, Horse, Human, Pig, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 77%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Pig: 86%; Rat: 79%
Image 1
Human Liver
Human Liver
Image 2
Human Jurkat
WB Suggested Anti-SART3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

SART3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |