HOXD4 Antibody - C-terminal region (ARP39116_T100)

Data Sheet
 
Product Number ARP39116_T100
Product Page www.avivasysbio.com/hoxd4-antibody-c-terminal-region-arp39116-t100.html
Name HOXD4 Antibody - C-terminal region (ARP39116_T100)
Protein Size (# AA) 255 amino acids
Molecular Weight 28kDa
NCBI Gene Id 3233
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Homeobox D4
Alias Symbols HOX4, HOX4B, HHO.C13, HOX-5.1, Hox-4.2
Peptide Sequence Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kosaki,K., (2002) Teratology 65 (2), 50-62
Description of Target HOXD4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.
Protein Interactions EP300; CREBBP; TIGD4; ASB8; ZSCAN18; CNOT7; ZBTB32; RNPS1; ZMYND11; HOXB13; DEDD; SNAI1; RXRG; HNRNPAB; ETV4; PBX1; HIPK1; MEIS1; XRCC6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXD4 (ARP39116_T100) antibody
Blocking Peptide For anti-HOXD4 (ARP39116_T100) antibody is Catalog # AAP39116 (Previous Catalog # AAPP21225)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HOXD4
Uniprot ID P09016
Protein Name Homeobox protein Hox-D4
Protein Accession # NP_055436
Purification Protein A purified
Nucleotide Accession # NM_014621
Tested Species Reactivity Human
Gene Symbol HOXD4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 77%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 92%; Rat: 100%
Image 1
Transfected 293T
WB Suggested Anti-HOXD4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com