CXXC1 Antibody - C-terminal region (ARP39110_T100)

Data Sheet
 
Product Number ARP39110_T100
Product Page www.avivasysbio.com/cxxc1-antibody-c-terminal-region-arp39110-t100.html
Name CXXC1 Antibody - C-terminal region (ARP39110_T100)
Protein Size (# AA) 656 amino acids
Molecular Weight 76kDa
NCBI Gene Id 30827
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name CXXC finger protein 1
Alias Symbols CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, ZCGPC1, HsT2645, 2410002I16Rik, 5830420C16Rik
Peptide Sequence Synthetic peptide located within the following region: RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lee,J.H. (2005) J. Biol. Chem. 280 (50), 41725-41731
Description of Target Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression.Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001).[supplied by OMIM].
Protein Interactions RBBP5; MEOX2; WDR5; SETD1A; ASH2L; TAX1BP1; WDR82; UBC; RNF2; HSP90AA1; SETD1B; TBP; MYC; SUMO2; PPP1CA; tat; NR5A1; SMURF1; HIST2H3C; HIST2H4A; MEN1; KIFC1; DNMT1; WDR82P1; WDR77; KMT2D; KMT2A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CXXC1 (ARP39110_T100) antibody
Blocking Peptide For anti-CXXC1 (ARP39110_T100) antibody is Catalog # AAP39110 (Previous Catalog # AAPP21219)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CXXC1
Uniprot ID Q9P0U4
Protein Name CpG-binding protein
Protein Accession # NP_055408
Purification Protein A purified
Nucleotide Accession # NM_014593
Tested Species Reactivity Human
Gene Symbol CXXC1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Transfected 293T
WB Suggested Anti-CXXC1 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com