BRD4 Antibody - C-terminal region (ARP39076_P050)

• Product Number: ARP39076_P050
• Name: BRD4 Antibody - C-terminal region (ARP39076_P050)
• Protein Size (# AA): 1,362 amino acids
• Molecular Weight: 152 kDa
• NCBI Gene Id: 23476
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Bromodomain containing 4
• Alias Symbols: CAP, MCAP, HUNK1, HUNKI
• Peptide Sequence: Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Schweiger,M.R., (2006) J. Virol. 80 (9), 4276-4285
• Description of Target: BRD4 is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.
• Protein Interactions: AFF1; CDK9; CCNT1; STAT3; JMJD6; TCERG1; HEXIM1; RN7SK; PRPF40A; vif; RPL6; MYC; MLLT1; ELAVL1; SUMO2; UBC; YWHAZ; KAT8; C8orf33; MESDC2; HIST1H4A; HIST1H3A; YWHAE; MED1; EP300; KDM5B; C7orf25; CHFR; CLDN1; RFC1; RFC4; HIST2H3C; HIST2H4A; MED12; MED24; ME
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-BRD4 (ARP39076_P050) antibody is Catalog # AAP39076 (Previous Catalog # AAPS05411)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BRD4
• Uniprot ID: O60885-2
• Protein Name: Bromodomain-containing protein 4
• Protein Accession #: NP_055114
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014299
• Tested Species Reactivity: Human
• Gene Symbol: BRD4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: CHIP, IF, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: HeLa
  
  Sample Type:
  HeLa
  Primary Antibody Dilution:
  4 ug/ml
  Secondary Antibody:
  Anti-rabbit Alexa 546
  Secondary Antibody Dilution:
  2 ug/ml
  Gene Name:
  BRD4
• Image 2: HCT116
  
  Chromatin Immunoprecipitation (ChIP) Using BRD4 antibody - C-terminal region (ARP39076_P050) and HCT116 Cells
• Image 3: Human Thymus
  
  WB Suggested Anti-BRD4 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Thymus
• Image 4: Human A549 Whole Cell
  
  Host: Rabbit
  Target Name: BRD4
  Sample Tissue: Human A549 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 5: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: BRD4
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 1ug/ml
• Image 6: Human 293T Whole Cell
  
  Host: Rabbit
  Target Name: BRD4
  Sample Tissue: Human 293T Whole Cell
  Antibody Dilution: 1ug/ml