| Product Number |
ARP38985_P050 |
| Product Page |
www.avivasysbio.com/myst4-antibody-n-terminal-region-arp38985-p050.html |
| Name |
MYST4 Antibody - N-terminal region (ARP38985_P050) |
| Protein Size (# AA) |
2073 amino acids |
| Molecular Weight |
231kDa |
| NCBI Gene Id |
23522 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
K(lysine) acetyltransferase 6B |
| Alias Symbols |
qkf, MORF, MOZ2, GTPTS, MYST4, ZC2HC6B, querkopf |
| Peptide Sequence |
Synthetic peptide located within the following region: MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Utley RT,(2003) Curr Top Microbiol Immunol. |
| Description of Target |
MYST4 is a histone acetyltransferase which may be involved in both positive and negative regulation of transcription. It is required for RUNX2-dependent transcriptional activation and May be involved in cerebral cortex development. |
| Protein Interactions |
UBC; HIST3H3; ATN1; SUMO1; RUNX2; RUNX1; ING5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KAT6B (ARP38985_P050) antibody |
| Blocking Peptide |
For anti-KAT6B (ARP38985_P050) antibody is Catalog # AAP38985 (Previous Catalog # AAPP22970) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MYST4 |
| Uniprot ID |
Q8WYB5 |
| Protein Name |
Histone acetyltransferase KAT6B |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that KAT6B is expressed in HepG2 |
| Protein Accession # |
AAH48199 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001256468 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KAT6B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-MYST4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that KAT6B is expressed in HepG2 |
|
