HBP1 Antibody - N-terminal region (ARP38976_P050)

Data Sheet
 
Product Number ARP38976_P050
Product Page www.avivasysbio.com/hbp1-antibody-n-terminal-region-arp38976-p050.html
Name HBP1 Antibody - N-terminal region (ARP38976_P050)
Protein Size (# AA) 514 amino acids
Molecular Weight 58kDa
NCBI Gene Id 26959
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name HMG-box transcription factor 1
Peptide Sequence Synthetic peptide located within the following region: MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yao,C.J., (2005) Leukemia 19 (11), 1958-1968
Description of Target HMG-box containing protein 1 (HBP1) is a member of the high mobility group (HMG) of chromosomal proteins. It is a sequence-specific HMG transcription factor. Several features of HBP1 suggest an intriguing role as a transcriptional and cell cycle regulator in differentiated cells and it may represent a unique transcriptional repressor with a role in initiation and establishment of cell cycle arrest during differentiation.
Protein Interactions FBXW11; UBC; TMEM37; SMAD1; ZNF212; KIAA1279; EWSR1; CD2AP; EP300; CREBBP; MYC; ANKRD2; SIN3A; SAP30; TCF4; HDAC1; RBL2; RB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HBP1 (ARP38976_P050) antibody
Blocking Peptide For anti-HBP1 (ARP38976_P050) antibody is Catalog # AAP38976 (Previous Catalog # AAPY00784)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HBP1
Uniprot ID O60381
Protein Name HMG box-containing protein 1
Protein Accession # NP_036389
Purification Affinity Purified
Nucleotide Accession # NM_012257
Tested Species Reactivity Human
Gene Symbol HBP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-HBP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com