website statistics
Product Datasheet: ARP38966_T100 - TRIM32 antibody - C-terminal region (ARP38966_T100) - Aviva Systems Biology
 
TRIM32 antibody - C-terminal region (ARP38966_T100)
Data Sheet
 
Product Number ARP38966_T100
Product Page www.avivasysbio.com/trim32-antibody-c-terminal-region-arp38966-t100.html
Product Name TRIM32 antibody - C-terminal region (ARP38966_T100)
Size 100 ul
Gene Symbol TRIM32
Alias Symbols BBS11, HT2A, LGMD2H, TATIP
Protein Size (# AA) 653 amino acids
Molecular Weight 72kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 22954
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Tripartite motif containing 32
Description This is a rabbit polyclonal antibody against TRIM32. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY
Target Reference Chiang,A.P., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (16), 6287-6292
Description of Target TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Protein Interactions PTPN11; PDE9A; PTCD2; CLIP4; KCTD9; UBQLN1; TRIM32; RABAC1; ABI2; SCGB1A1; UBE2E1; UBE2D1; UBC; TP53; SDCBP; UBE2U; SYT6; MYCN; CEP250; CUL3; GPRASP2; GLIS2; YWHAB; TP73; UBE2D3; UBE2D2; HSP90AA1; SFN; YWHAQ; YWHAZ; YWHAH; YWHAG; YWHAE; NOTCH1; UBD; TOP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Additional Information IHC Information: Transfected 293T cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-TRIM32 (ARP38966_T100) antibody is Catalog # AAP38966 (Previous Catalog # AAPY00775)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM32
Complete computational species homology data Anti-TRIM32 (ARP38966_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TRIM32.
Swissprot Id Q13049
Protein Name E3 ubiquitin-protein ligase TRIM32
Sample Type Confirmation

TRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_036342
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TRIM32.
Nucleotide Accession # NM_012210
Replacement Item This antibody may replace item sc-134120 from Santa Cruz Biotechnology.
Conjugation Options

ARP38966_T100-FITC Conjugated

ARP38966_T100-HRP Conjugated

ARP38966_T100-Biotin Conjugated

CB Replacement sc-134120; sc-135588; sc-49265; sc-49266; sc-61714; sc-61715; sc-99011
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Image 1
Human Muscle
Human Muscle
Image 2
Human 293T
WB Suggested Anti-TRIM32 Antibody Titration: 1.025 ug/ml
Positive Control: 293T cells lysate

TRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com