| Product Number |
ARP38956_P050 |
| Product Page |
www.avivasysbio.com/ciz1-antibody-c-terminal-region-arp38956-p050.html |
| Name |
CIZ1 Antibody - C-terminal region (ARP38956_P050) |
| Protein Size (# AA) |
898 amino acids |
| Molecular Weight |
100kDa |
| NCBI Gene Id |
25792 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CDKN1A interacting zinc finger protein 1 |
| Alias Symbols |
NP94, LSFR1, ZNF356 |
| Peptide Sequence |
Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Warder,D.E. (2003) J. Biomed. Sci. 10 (4), 406-417 |
| Description of Target |
CIZ1 may regulate the subcellular localization of CIP/WAF1. |
| Protein Interactions |
BMI1; UPF2; ERH; SH3KBP1; SH3BP4; UBC; Dynll1; CDKN1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CIZ1 (ARP38956_P050) antibody |
| Blocking Peptide |
For anti-CIZ1 (ARP38956_P050) antibody is Catalog # AAP38956 (Previous Catalog # AAPY00765) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CIZ1 |
| Uniprot ID |
Q9ULV3 |
| Protein Name |
Cip1-interacting zinc finger protein |
| Protein Accession # |
NP_036259 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_012127 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CIZ1 |
| Predicted Species Reactivity |
Human, Horse |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 77%; Human: 100% |
| Image 1 | Human Lung
 | Human Lung |
| | Image 2 | Transfected 293T
 | WB Suggested Anti-CIZ1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
|
