ELL2 Antibody - C-terminal region (ARP38946_P050)

Data Sheet
 
Product Number ARP38946_P050
Product Page www.avivasysbio.com/ell2-antibody-c-terminal-region-arp38946-p050.html
Name ELL2 Antibody - C-terminal region (ARP38946_P050)
Protein Size (# AA) 640 amino acids
Molecular Weight 72kDa
NCBI Gene Id 22936
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Elongation factor, RNA polymerase II, 2
Alias Symbols MRCCAT1
Peptide Sequence Synthetic peptide located within the following region: PGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target ELL2 is the elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA.
Protein Interactions AFF1; MED19; EAF1; EAF2; AFF4; ICE1; MED26; CASK; UBC; MLLT3; MLLT1; CDK9; CCNT2; CCNT1; SIAH1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ELL2 (ARP38946_P050) antibody
Blocking Peptide For anti-ELL2 (ARP38946_P050) antibody is Catalog # AAP38946 (Previous Catalog # AAPY00755)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ELL2
Uniprot ID O00472
Protein Name RNA polymerase II elongation factor ELL2
Protein Accession # NP_036213
Purification Affinity Purified
Nucleotide Accession # NM_012081
Tested Species Reactivity Human
Gene Symbol ELL2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human ACHN
WB Suggested Anti-ELL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com