BRD3 Antibody - N-terminal region (ARP38939_T100)

• Product Number: ARP38939_T100
• Name: BRD3 Antibody - N-terminal region (ARP38939_T100)
• Protein Size (# AA): 556 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 8019
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Bromodomain containing 3
• Alias Symbols: ORFX, RING3L
• Peptide Sequence: Synthetic peptide located within the following region: MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ishii,H., (2005) DNA Cell Biol. 24 (7), 432-437
• Description of Target: This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. BRD3 is ubiquitously expressed in human adult and fetal tissues. BRD3 is markedly expressed in undifferentiated ES cells, whereas the expression was reduced upon endothelial differentiation. BRD3 plays a role in regulation of cell proliferation by allowing cells to enter the proliferative phase of the angiogenic process.BRD3 is also involved in bladder cancer.
• Protein Interactions: SRPK2; MYC; UBC; YEATS4; APP; SPP1; ELAVL1; MAP1LC3B; tat; BRD7;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-BRD3 (ARP38939_T100) antibody is Catalog # AAP38939 (Previous Catalog # AAPY00748)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BRD3
• Uniprot ID: Q5T1R6
• Sample Type Confirmation:

  BRD3 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: AAH32124
• Purification: Protein A purified
• Nucleotide Accession #: NM_007371
• Tested Species Reactivity: Human
• Gene Symbol: BRD3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-BRD3 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysateBRD3 is supported by BioGPS gene expression data to be expressed in Jurkat