PMF1 Antibody - N-terminal region (ARP38922_P050)

Data Sheet
 
Product Number ARP38922_P050
Product Page www.avivasysbio.com/pmf1-antibody-n-terminal-region-arp38922-p050.html
Name PMF1 Antibody - N-terminal region (ARP38922_P050)
Protein Size (# AA) 165 amino acids
Molecular Weight 19kDa
NCBI Gene Id 11243
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Polyamine-modulated factor 1
Alias Symbols RP11-54H19.4
Peptide Sequence Synthetic peptide located within the following region: MVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQRIYDKFIAQLQTSIRE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wang,Y., Biochem. J. 366 (PT 1), 79-86 (2002)
Description of Target PMF1 is part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. It may act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
Protein Interactions USHBP1; MIS12; KDM1A; SUGT1; TCP10L; UBC; DSN1; COPS7A; NFE2L2; HSP90AA1; KIAA1377; COPS6; MED31; COPS7B; GIT1; CRMP1; GDF9; PTN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PMF1 (ARP38922_P050) antibody
Blocking Peptide For anti-PMF1 (ARP38922_P050) antibody is Catalog # AAP38922 (Previous Catalog # AAPY00731)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PMF1
Uniprot ID Q6P1K2
Protein Name Polyamine-modulated factor 1
Protein Accession # NP_009152
Purification Affinity Purified
Nucleotide Accession # NM_007221
Tested Species Reactivity Human
Gene Symbol PMF1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Goat: 100%; Guinea Pig: 92%; Horse: 93%; Human: 93%; Mouse: 77%; Pig: 93%; Rabbit: 93%; Rat: 85%
Image 1
Human kidney
Human kidney
Image 2
Human Heart
Human Heart
Image 3
Transfected 293T
WB Suggested Anti-PMF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com