Product Number |
ARP38884_P050 |
Product Page |
www.avivasysbio.com/znf16-antibody-n-terminal-region-arp38884-p050.html |
Name |
ZNF16 Antibody - N-terminal region (ARP38884_P050) |
Protein Size (# AA) |
682 amino acids |
Molecular Weight |
76kDa |
NCBI Gene Id |
7564 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 16 |
Alias Symbols |
HZF1, KOX9 |
Peptide Sequence |
Synthetic peptide located within the following region: MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Dreier,B., (2000) J. Mol. Biol. 303 (4), 489-502 |
Description of Target |
ZNF16 contains a C2H2 type of zinc finger, and thus may function as a transcription factor.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified. |
Protein Interactions |
ZNF101; GORAB; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF16 (ARP38884_P050) antibody |
Blocking Peptide |
For anti-ZNF16 (ARP38884_P050) antibody is Catalog # AAP38884 (Previous Catalog # AAPP21090) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF16 |
Uniprot ID |
P17020 |
Protein Name |
Zinc finger protein 16 |
Protein Accession # |
NP_008889 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006958 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF16 |
Predicted Species Reactivity |
Human, Mouse, Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 80%; Pig: 100% |
Image 1 | Human Lung
| Human Lung |
| Image 2 | Transfected 293T
| WB Suggested Anti-ZNF16 Antibody Titration: 0.03ug/ml ELISA Titer: 1:1562500 Positive Control: Transfected 293T |
|
|