Product Number |
ARP38883_T100 |
Product Page |
www.avivasysbio.com/sox15-antibody-middle-region-arp38883-t100.html |
Name |
SOX15 Antibody - middle region (ARP38883_T100) |
Protein Size (# AA) |
233 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
6665 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
SRY (sex determining region Y)-box 15 |
Alias Symbols |
SOX20, SOX26, SOX27 |
Peptide Sequence |
Synthetic peptide located within the following region: ASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Schepers,G.E., (2002) Dev. Cell 3 (2), 167-170 |
Description of Target |
SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. |
Protein Interactions |
HSFY1; BHLHE40; HOXB9; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SOX15 (ARP38883_T100) antibody |
Blocking Peptide |
For anti-SOX15 (ARP38883_T100) antibody is Catalog # AAP38883 (Previous Catalog # AAPS04607) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SOX15 |
Uniprot ID |
O60248 |
Protein Name |
Protein SOX-15 |
Protein Accession # |
NP_008873 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006942 |
Tested Species Reactivity |
Human |
Gene Symbol |
SOX15 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 86% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Transfected 293T
| WB Suggested Anti-SOX15 Antibody Titration: 1.25ug/ml Positive Control: Transfected 293T |
|
|